PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.094180.1
Common NameCsa_4G022940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 308aa    MW: 35355.9 Da    PI: 6.8606
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.094180.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.11.1e-141156146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqk 46
                     +g+WT+eEde+l+++v+++G+++W++  r  g + Rt+k+c++rw +
   Cucsa.094180.1 11 KGPWTAEEDEILINYVNKFGPRDWSS-LRSKGlLPRTGKSCRLRWVN 56
                     79************************.66667788**********87 PP

2Myb_DNA-binding41.53e-1367108346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T++E+   +++ +q+G++ W++Ia ++  gRt++++k++w +
   Cucsa.094180.1  67 KFTADEERVVIELQAQFGNK-WAKIATYLE-GRTDNDVKNFWST 108
                      79******************.*********.***********65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.615658IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-20959IPR009057Homeodomain-like
SuperFamilySSF466894.69E-289106IPR009057Homeodomain-like
SMARTSM007172.0E-121060IPR001005SANT/Myb domain
PfamPF002491.1E-121156IPR001005SANT/Myb domain
CDDcd001673.59E-121358No hitNo description
PROSITE profilePS5129419.50959114IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-1760112IPR009057Homeodomain-like
SMARTSM007174.7E-1164112IPR001005SANT/Myb domain
PfamPF002492.2E-1167107IPR001005SANT/Myb domain
CDDcd001673.10E-967106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MERQKGIVMK KGPWTAEEDE ILINYVNKFG PRDWSSLRSK GLLPRTGKSC RLRWVNRLQP  60
NLKTGCKFTA DEERVVIELQ AQFGNKWAKI ATYLEGRTDN DVKNFWSTRR KRLEKILQTP  120
PQKSQKNKQR IWLMYLQVPS SSSSQPDEQS STWKDHFKNA FQLGNSEMHK MATLSVQSNM  180
LTMENENQIF GTSTIHMVAP FDPFSHCCFS QFAQSSQEIG MFPDCHGLAP NHIPCNVQDV  240
FEPGETLETN NSLHFMSNSM PKEQEIKAES SLEVKNGNPY YTTPDDCFDD FTADLFDFFD  300
RSPPSLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-26911325128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818740.0LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011654333.11e-128PREDICTED: uncharacterized protein LOC105435342
TrEMBLA0A0A0KUD20.0A0A0A0KUD2_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.16e-63MYB family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]